Novus Biologicals™ Beclin 1 Antibody Pack
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB91095610-Each-of-1 | In Stock | ₹ 71,185.92 |
NB91095610 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 71,185.92
GST (18%): ₹ 12,813.466
Total Price: ₹ 83,999.386
Antigen
Beclin 1
Conjugate
Unconjugated
Formulation
See individual datasheets
Gene Symbols
BECN1
Quantity
3 Vials
Gene ID (Entrez)
8678
Target Species
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin), KnockDown
Dilution
Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
Gene Alias
ATG6, ATG6 autophagy related 6 homolog, beclin 1 (coiled-coil, moesin-like BCL2 interacting protein), beclin 1 (coiled-coil, moesin-like BCL2-interacting protein), beclin 1, autophagy related, beclin1, beclin-1, Coiled-coil myosin-like BCL2-interacting protein, GT197, Protein GT197, VPS30
Immunogen
See individual datasheets
Research Discipline
Cancer, mTOR Pathway
Includes
1.NB110-87318: Beclin 1/ATG6 Antibody2.NB500-249: Beclin 1/ATG6 Antibody3.NB500-266: Beclin 1/ATG6 Antibody
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Compare Similar Items
Show Difference
Antigen: Beclin 1
Conjugate: Unconjugated
Formulation: See individual datasheets
Gene Symbols: BECN1
Quantity: 3 Vials
Gene ID (Entrez): 8678
Target Species: Human, Mouse, Rat
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin), KnockDown
Dilution: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
Gene Alias: ATG6, ATG6 autophagy related 6 homolog, beclin 1 (coiled-coil, moesin-like BCL2 interacting protein), beclin 1 (coiled-coil, moesin-like BCL2-interacting protein), beclin 1, autophagy related, beclin1, beclin-1, Coiled-coil myosin-like BCL2-interacting protein, GT197, Protein GT197, VPS30
Immunogen: See individual datasheets
Research Discipline: Cancer, mTOR Pathway
Includes: 1.NB110-87318: Beclin 1/ATG6 Antibody2.NB500-249: Beclin 1/ATG6 Antibody3.NB500-266: Beclin 1/ATG6 Antibody
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: Tight Junction Protein 1
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Symbols: TJP1
Quantity: 20 μL
Gene ID (Entrez): 7082
Target Species: Rat
Applications: Western Blot
Dilution: Western Blot 1:1000
Gene Alias: DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1
Immunogen: Synthetic peptide directed towards ZO-1 tight junction protein. Peptide sequence AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE.
Research Discipline: __
Includes: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: CD25/IL-2 R alpha
Conjugate: DyLight 488
Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
Gene Symbols: IL2RA
Quantity: 0.1 mL
Gene ID (Entrez): 3559
Target Species: Mouse
Applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin)
Dilution: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Alias: CD25, CD25 antigen, IDDM10, IL-2 receptor subunit alpha, IL2R, IL-2R subunit alpha, IL-2-RA, IL2-RA, interleukin 2 receptor, alpha, interleukin-2 receptor subunit alpha, p55, TAC antigen, TCGFR
Immunogen: This antibody was produced from a hybridoma (mouse myeloma fused with spleen cells from a rat immunized with recombinant mouse CD25 protein.
Research Discipline: Adaptive Immunity, Apoptosis, Biologically Active Proteins, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mast Cell Markers, Signal Transduction
Includes: __
Content And Storage: Store at 4C in the dark.