Hsp47 Antibody (1C4-1A6), Novus Biologicals™
Mouse Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Hsp47
Concentration
1 mg/mL
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Host Species
Mouse
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene Accession No.
P50454.2
Gene ID (Entrez)
871
Immunogen
Human HSP47, full length
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Clone
1C4-1A6
Dilution
Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human
Gene Alias
(collagen binding protein 1), Arsenic-transactivated protein 3, AsTP3, CBP1, CBP2RA-A47, Cell proliferation-inducing gene 14 protein, Collagen-binding protein, colligen, Colligin, colligin-1, colligin-2, gp46, HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), member 2, member 2, (collagen-binding protein 2), PPROM, proliferation-inducing gene 14, rheumatoid arthritis antigen A-47,47 kDa heat shock protein, Rheumatoid arthritis-related antigen RA-A47, serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), serpin H1, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, SERPINH2colligin
Gene Symbols
SERPINH1
Isotype
IgG1 κ
Purification Method
Protein G purified
Test Specificity
Detects 47kDa.
Related Products
Description
- Hsp47 Monoclonal specifically detects Hsp47 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Hsp47
Concentration: 1 mg/mL
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Host Species: Mouse
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene Accession No.: P50454.2
Gene ID (Entrez): 871
Immunogen: Human HSP47, full length
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Clone: 1C4-1A6
Dilution: Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: (collagen binding protein 1), Arsenic-transactivated protein 3, AsTP3, CBP1, CBP2RA-A47, Cell proliferation-inducing gene 14 protein, Collagen-binding protein, colligen, Colligin, colligin-1, colligin-2, gp46, HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), member 2, member 2, (collagen-binding protein 2), PPROM, proliferation-inducing gene 14, rheumatoid arthritis antigen A-47,47 kDa heat shock protein, Rheumatoid arthritis-related antigen RA-A47, serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), serpin H1, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, SERPINH2colligin
Gene Symbols: SERPINH1
Isotype: IgG1 κ
Purification Method: Protein G purified
Test Specificity: Detects 47kDa.
Antigen: ZNF713
Concentration: __
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: __
Gene Accession No.: Q8N859
Gene ID (Entrez): 349075
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHK
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Clone: __
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Form: __
Regulatory Status: RUO
Target Species: Human
Gene Alias: FLJ39963, zinc finger protein 713
Gene Symbols: ZNF713
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ZNF713
Concentration: __
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: __
Gene Accession No.: Q8N859
Gene ID (Entrez): 349075
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHK
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Clone: __
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Form: __
Regulatory Status: RUO
Target Species: Human
Gene Alias: FLJ39963, zinc finger protein 713
Gene Symbols: ZNF713
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.