CTDSPL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
CTDSPL
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Accession No.
O15194
Gene ID (Entrez)
10217
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Signal Transduction
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22
Gene Symbols
CTDSPL
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- CTDSPL Polyclonal specifically detects CTDSPL in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CTDSPL
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: O15194
Gene ID (Entrez): 10217
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22
Gene Symbols: CTDSPL
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: LRRC58
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: Q96CX6
Gene ID (Entrez): 116064
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Leucine Rich Repeat Containing 58, Leucine-Rich Repeat-Containing Protein 58
Gene Symbols: LRRC58
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Hikeshi
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: Q53FT3
Gene ID (Entrez): 51501
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: chromosome 11 open reading frame 73, FLJ43020, Hikeshi, HSPC138, HSPC179, L7RN6, lethal, Chr 7, Rinchik 6
Gene Symbols: C11ORF73
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
