CTDSPL Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB437153-Each-of-1 | In Stock | ₹ 32,683.92 |
NB437153 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
CTDSPL
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
O15194
Gene Symbols
CTDSPL
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
Quantity
25 μL
Research Discipline
Signal Transduction
Gene ID (Entrez)
10217
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CTDSPL Polyclonal specifically detects CTDSPL in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CTDSPL
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: O15194
Gene Symbols: CTDSPL
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
Quantity: 25 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 10217
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: C2orf68
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q2NKX9
Gene Symbols: C2orf68
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 388969
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: chromosome 2 open reading frame 68, FLJ35653, MGC131675
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: SULT1A2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P50226
Gene Symbols: SULT1A2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 6799
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Aryl sulfotransferase 2, arylamine sulfotransferase, EC 2.8.2, EC 2.8.2.1, HAST4, MGC142287, MGC142289, Phenol sulfotransferase 2, phenolic-metabolizing (P) form of PST, phenol-preferring phenol sulfotransferase2, Phenol-sulfating phenol sulfotransferase 2, P-PST 2, ST1A2, STP2P-PST, sulfotransferase 1A2, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2, thermostable phenol sulfotransferase, TSPST2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
