RIAM/APBB1IP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
RIAM/APBB1IP
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Accession No.
Q7Z5R6
Gene ID (Entrez)
54518
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1
Gene Symbols
APBB1IP
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- RIAM/APBB1IP Polyclonal specifically detects RIAM/APBB1IP in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: RIAM/APBB1IP
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: Q7Z5R6
Gene ID (Entrez): 54518
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1
Gene Symbols: APBB1IP
Isotype: IgG
Purification Method: Affinity Purified
Antigen: RCOR1/CoREST
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: Q9UKL0
Gene ID (Entrez): 23186
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLV
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0071CORESTRCORREST corepressor, Protein CoREST, REST corepressor 1
Gene Symbols: RCOR1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: RCOR1/CoREST
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: Q9UKL0
Gene ID (Entrez): 23186
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLV
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0071CORESTRCORREST corepressor, Protein CoREST, REST corepressor 1
Gene Symbols: RCOR1
Isotype: IgG
Purification Method: Affinity Purified
