RIAM/APBB1IP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP239009-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP239009 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
RIAM/APBB1IP
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
Q7Z5R6
Gene Symbols
APBB1IP
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
54518
Target Species
Human
Isotype
IgG
Related Products
Description
- RIAM/APBB1IP Polyclonal specifically detects RIAM/APBB1IP in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: RIAM/APBB1IP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q7Z5R6
Gene Symbols: APBB1IP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 54518
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 54518
Target Species: __
Isotype: __
Antigen: MMP-9
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: P14780
Gene Symbols: MMP9
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 92 kDa gelatinase, 92 kDa type IV collagenase, CLG4B, EC 3.4.24, EC 3.4.24.35, Gelatinase B, GELB, macrophage gelatinase, MANDP2, matrix metallopeptidase 9, matrix metalloproteinase 9, matrix metalloproteinase-9, MMP-9, type V collagenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4318
Target Species: Human
Isotype: IgG