MCM3AP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
MCM3AP
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene ID (Entrez)
8888
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein
Gene Symbols
MCM3AP
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- Description MCM3AP Polyclonal specifically detects MCM3AP in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MCM3AP
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 8888
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: 80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein
Gene Symbols: MCM3AP
Isotype: IgG
Purification Method: Affinity Purified
Antigen: METTL1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 4234
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: C12orf1, D1075-like gene product, EC 2.1.1.33, FLJ95748, methyltransferase like 1, methyltransferase-like 1, Methyltransferase-like protein 1, TRM8, tRNA (guanine-N(7)-)-methyltransferase, tRNA(m7G46)-methyltransferase, YDL201w
Gene Symbols: METTL1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: POU3F3
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 5455
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QGPDVKGGAGRDDLHAGTALHHR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: brain-1, Brain-specific homeobox/POU domain protein 1, Brn-1, BRN1brn-1, Oct-8, Octamer-binding protein 8, Octamer-binding transcription factor 8, OTF-8, OTF8oct-8, POU class 3 homeobox 3, POU domain class 3, transcription factor 3, POU domain, class 3, transcription factor 3
Gene Symbols: POU3F3
Isotype: IgG
Purification Method: Affinity Purified
