TRAP220/MED1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
TRAP220/MED1
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cancer
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
5469
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
Activator-recruited cofactor 205 kDa component, ARC205, CRSP1TRIP2, CRSP200p53 regulatory protein RB18A, DRIP230PPAR-binding protein, mediator complex subunit 1DRIP205, mediator of RNA polymerase II transcription subunit 1, PBPPPARGBP, Peroxisome proliferator-activated receptor-binding protein, PPAR binding protein, PPARBPMGC71488, PPARG binding protein, RB18ATR-interacting protein 2, Thyroid hormone receptor-associated protein complex 220 kDa component, thyroid hormone receptor-associated protein complex component TRAP220, thyroid receptor interacting protein 2, Thyroid receptor-interacting protein 2, Trap220, TRAP220TRIP-2, vitamin D receptor-interacting protein 230 kD, Vitamin D receptor-interacting protein complex component DRIP205
Gene Symbols
MED1
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- TRAP220/MED1 Polyclonal specifically detects TRAP220/MED1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TRAP220/MED1
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 5469
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Activator-recruited cofactor 205 kDa component, ARC205, CRSP1TRIP2, CRSP200p53 regulatory protein RB18A, DRIP230PPAR-binding protein, mediator complex subunit 1DRIP205, mediator of RNA polymerase II transcription subunit 1, PBPPPARGBP, Peroxisome proliferator-activated receptor-binding protein, PPAR binding protein, PPARBPMGC71488, PPARG binding protein, RB18ATR-interacting protein 2, Thyroid hormone receptor-associated protein complex 220 kDa component, thyroid hormone receptor-associated protein complex component TRAP220, thyroid receptor interacting protein 2, Thyroid receptor-interacting protein 2, Trap220, TRAP220TRIP-2, vitamin D receptor-interacting protein 230 kD, Vitamin D receptor-interacting protein complex component DRIP205
Gene Symbols: MED1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: PJA2/Praja2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Zinc Finger
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9867
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRW
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: E3 ubiquitin-protein ligase Praja-2, EC 6.3.2, EC 6.3.2.-, KIAA0438praja2, Neurodap1, praja ring finger 2, Praja2, RING finger protein 131praja 2, RING-H2 motif containing, RNF131
Gene Symbols: PJA2
Isotype: IgG
Purification Method: Affinity Purified
Antigen: PJA2/Praja2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Zinc Finger
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9867
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRW
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: E3 ubiquitin-protein ligase Praja-2, EC 6.3.2, EC 6.3.2.-, KIAA0438praja2, Neurodap1, praja ring finger 2, Praja2, RING finger protein 131praja 2, RING-H2 motif containing, RNF131
Gene Symbols: PJA2
Isotype: IgG
Purification Method: Affinity Purified
