MED14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
MED14
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Signal Transduction
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
9282
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, transcriptional co-activator CRSP150, Transcriptional coactivator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component
Gene Symbols
MED14
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- Description MED14 Polyclonal specifically detects MED14 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MED14
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9282
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, transcriptional co-activator CRSP150, Transcriptional coactivator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component
Gene Symbols: MED14
Isotype: IgG
Purification Method: Affinity Purified
Antigen: DOK6
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 220164
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYW
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: docking protein 5-like, docking protein 6, DOK5L, Downstream of tyrosine kinase 6, HsT3226, MGC20785
Gene Symbols: DOK6
Isotype: IgG
Purification Method: Affinity Purified
Antigen: Mitochondrial-processing peptidase subunit beta
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9512
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Beta-MPP, EC 3.4.24.64, mitochondrial processing peptidase beta subunit, mitochondrial-processing peptidase subunit beta, MPPBMPP11, MPPP52, P-52, peptidase (mitochondrial processing) beta
Gene Symbols: PMPCB
Isotype: IgG
Purification Method: Affinity Purified
