HADHB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
HADHB
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Gene Symbols
HADHB
Isotype
IgG
Purification Method
Affinity Purified
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
metabolism
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
3032
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- HADHB Polyclonal specifically detects HADHB in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: HADHB
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Gene Symbols: HADHB
Isotype: IgG
Purification Method: Affinity Purified
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: metabolism
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 3032
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ARL3
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3
Gene Symbols: ARL3
Isotype: IgG
Purification Method: Affinity Purified
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 403
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: METTL22
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: C16orf68, methyltransferase like 22
Gene Symbols: METTL22
Isotype: IgG
Purification Method: Affinity Purified
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 79091
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NACTAILSVEKRLNFTLRHLDVTCEAYDHFRSCLHALEQLTDGKLRFVVEPVEASFPQLLVYERLQQLELWKIIAEP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
