HADHB Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB403751-Each-of-1 | In Stock | ₹ 32,683.92 |
NB403751 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
HADHB
Classification
Polyclonal
Dilution
Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias
2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
HADHB
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
Quantity
25 μL
Research Discipline
metabolism
Gene ID (Entrez)
3032
Target Species
Human
Form
Purified
Related Products
Description
- HADHB Polyclonal specifically detects HADHB in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: HADHB
Classification: Polyclonal
Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HADHB
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
Quantity: 25 μL
Research Discipline: metabolism
Gene ID (Entrez): 3032
Target Species: Human
Form: Purified
Antigen: HEATR3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias: FLJ20718, HEAT repeat containing 3, HEAT repeat-containing protein 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HEATR3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 55027
Target Species: Human
Form: Purified
Antigen: IRF2BPL
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias: C14orf4, EAP1, IRF2BPL interferon regulatory factor 2 binding protein-like
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: IRF2BPL
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 64207
Target Species: Human
Form: Purified
