ACTH Mouse, Clone: AH26 + 57, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ACTH
Dilution
Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Accession No.
P01189
Gene ID (Entrez)
5443
Immunogen
Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Primary or Secondary
Primary
Content And Storage
Store at 4C.
Clone
AH26 + 57
Applications
Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Mouse
Research Discipline
Neuroscience, Nutrient Sensing in the Brain
Formulation
PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias
ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene Symbols
POMC
Isotype
IgG
Purification Method
Protein A purified
Test Specificity
ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Related Products
Description
- ACTH Monoclonal specifically detects ACTH in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ACTH
Dilution: Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Accession No.: P01189
Gene ID (Entrez): 5443
Immunogen: Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Primary or Secondary: Primary
Content And Storage: Store at 4C.
Clone: AH26 + 57
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Mouse
Research Discipline: Neuroscience, Nutrient Sensing in the Brain
Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias: ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene Symbols: POMC
Isotype: IgG
Purification Method: Protein A purified
Test Specificity: ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Antigen: DOG1/TMEM16A
Dilution: Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: Q5XXA6
Gene ID (Entrez): 55107
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
Primary or Secondary: Primary
Content And Storage: Store at 4C.
Clone: DG1/447 + DOG-1.1
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Mouse
Research Discipline: __
Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias: ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Gene Symbols: ANO1
Isotype: IgG
Purification Method: Protein A purified
Test Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Antigen: Prolactin R
Dilution: Western Blot 0.25-0.5ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: P16471
Gene ID (Entrez): 5618
Immunogen: Semi-purified human prolactin receptor (B6.2); Recombinant human prolactin receptor (PRLR742)
Primary or Secondary: Primary
Content And Storage: Store at 4C.
Clone: B6.2+PRLR742
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Mouse
Research Discipline: Apoptosis
Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias: delta 4-delta 7/11 truncated prolactin receptor, delta 4-SF1b truncated prolactin receptor, hPRL receptor, hPRLrI, PRL-R, prolactin receptor, prolactin receptor delta 7/11, secreted prolactin binding protein
Gene Symbols: PRLR
Isotype: IgG
Purification Method: Protein A purified
Test Specificity: It recognizes a protein of 70kDa, identified as prolactin receptor. Prolactin is a pituitary hormone involved in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The initial step in its action is the binding to a specific membrane receptor (prolactin receptor), which belongs to the superfamily of class 1 cytokine receptors. The function of the prolactin receptor is mediated, at least in part, by two families of signaling molecules: Janus kinases and signal transducers and activators of transcription.