AP3S1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AP3S1
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
Q92572
Gene ID (Entrez)
1176
Immunogen
Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
Adapter-related protein complex 3 sigma-1 subunit, adaptor-related protein complex 3, sigma 1 subunit, AP-3 complex sigma-3A subunit, AP-3 complex subunit sigma-3A, CLAPS3AP-3 complex subunit sigma-1, Clathrin-associated/assembly/adapter protein, small 3, clathrin-associated/assembly/adaptor protein, small 3 (22kD), Sigma3A, sigma-3A-adaptin, Sigma3A-adaptin, Sigma-adaptin 3a
Gene Symbols
AP3S1
Isotype
IgG
Molecular Weight of Antigen
22 kDa
Related Products
Description
- AP3S1 Polyclonal specifically detects AP3S1 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: AP3S1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q92572
Gene ID (Entrez): 1176
Immunogen: Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Adapter-related protein complex 3 sigma-1 subunit, adaptor-related protein complex 3, sigma 1 subunit, AP-3 complex sigma-3A subunit, AP-3 complex subunit sigma-3A, CLAPS3AP-3 complex subunit sigma-1, Clathrin-associated/assembly/adapter protein, small 3, clathrin-associated/assembly/adaptor protein, small 3 (22kD), Sigma3A, sigma-3A-adaptin, Sigma3A-adaptin, Sigma-adaptin 3a
Gene Symbols: AP3S1
Isotype: IgG
Molecular Weight of Antigen: 22 kDa
Antigen: KLHL7
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q8IXQ5-2
Gene ID (Entrez): 55975
Immunogen: Synthetic peptides corresponding to KLHL7(kelch-like 7 (Drosophila)) The peptide sequence was selected from the middle region of KLHL7. Peptide sequence AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: kelch (Drosophila)-like 6, kelch/BTB, kelch-like 6, kelch-like 7 (Drosophila), kelch-like protein 7, KLHL6, RP42, SBBI26
Gene Symbols: KLHL7
Isotype: IgG
Molecular Weight of Antigen: 62 kDa
Antigen: LDHAL6B
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9BYZ2
Gene ID (Entrez): 92483
Immunogen: Synthetic peptides corresponding to LDHAL6B(lactate dehydrogenase A-like 6B) The peptide sequence was selected from the middle region of LDHAL6B. Peptide sequence SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: EC 1.1.1, lactate dehydrogenase A-like 6, lactate dehydrogenase A-like 6B, LDH6B, LDHAL6, LDHLEC 1.1.1.27, L-lactate dehydrogenase A-like 6B
Gene Symbols: LDHAL6B
Isotype: IgG
Molecular Weight of Antigen: 42 kDa
