SNRPB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SNRPB
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
Q66K91
Gene ID (Entrez)
6628
Immunogen
Synthetic peptides corresponding to SNRPB(small nuclear ribonucleoprotein polypeptides B and B1) The peptide sequence was selected from the middle region of SNRPB. Peptide sequence LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMP.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
CODB polypeptide of Sm protein, Sm protein B/B', small nuclear ribonucleoprotein polypeptides B and B', small nuclear ribonucleoprotein polypeptides B and B1, small nuclear ribonucleoprotein-associated proteins B and B', SmB/B', Sm-B/B'sm-B/Sm-B', SmB/SmB', snRNP-Bsmall nuclear ribonucleoprotein polypeptide B, SNRPB1
Gene Symbols
SNRPB
Isotype
IgG
Related Products
Description
- SNRPB Polyclonal specifically detects SNRPB in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: SNRPB
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q66K91
Gene ID (Entrez): 6628
Immunogen: Synthetic peptides corresponding to SNRPB(small nuclear ribonucleoprotein polypeptides B and B1) The peptide sequence was selected from the middle region of SNRPB. Peptide sequence LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMP.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: CODB polypeptide of Sm protein, Sm protein B/B', small nuclear ribonucleoprotein polypeptides B and B', small nuclear ribonucleoprotein polypeptides B and B1, small nuclear ribonucleoprotein-associated proteins B and B', SmB/B', Sm-B/B'sm-B/Sm-B', SmB/SmB', snRNP-Bsmall nuclear ribonucleoprotein polypeptide B, SNRPB1
Gene Symbols: SNRPB
Isotype: IgG
Antigen: UPF3A
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9H1J1
Gene ID (Entrez): 65110
Immunogen: Synthetic peptides corresponding to UPF3A(UPF3 regulator of nonsense transcripts homolog A (yeast)) The peptide sequence was selected from the middle region of UPF3A (NP_075387). Peptide sequence QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3
Gene Symbols: UPF3A
Isotype: IgG
Antigen: DNA helicase B
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q8NG08
Gene ID (Entrez): 92797
Immunogen: Synthetic peptides corresponding to DNA helicase B The peptide sequence was selected from the N terminal of DNA helicase B. Peptide sequence FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: DNA helicase B, hDHB, helicase (DNA) B
Gene Symbols: HELB
Isotype: IgG