Solute carrier family 22 member 18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Solute carrier family 22 member 18
Classification
Polyclonal
Host Species
Rabbit
Gene Alias
BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Gene Symbols
SLC22A18
Isotype
IgG
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene ID (Entrez)
5002
Immunogen
Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG.
Primary or Secondary
Primary
Related Products
Description
- Solute carrier family 22 member 18 Polyclonal specifically detects Solute carrier family 22 member 18 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Solute carrier family 22 member 18
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Gene Symbols: SLC22A18
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 5002
Immunogen: Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG.
Primary or Secondary: Primary
Antigen: RNF182
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: E3 ubiquitin-protein ligase RNF182, EC 6.3.2.-, FLJ40772, ring finger protein 182MGC33993
Gene Symbols: RNF182
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 221687
Immunogen: Synthetic peptides corresponding to RNF182(ring finger protein 182) The peptide sequence was selected from the N terminal of RNF182. Peptide sequence CLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSP.
Primary or Secondary: Primary
Antigen: TMEM82
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: transmembrane protein 82
Gene Symbols: TMEM82
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 388595
Immunogen: Synthetic peptides corresponding to TMEM82(transmembrane protein 82) The peptide sequence was selected from the N terminal of TMEM82. Peptide sequence LETVHLAGLALFLTVVGSRVAALVVLEFSLRAVSTLLSLGKGSQGAAERL.
Primary or Secondary: Primary
