Manufacturer: Fischer Scientific
Pack Size | SKU | Availability | Price |
---|---|---|---|
Each of 1 | NBP159747-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159747 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Solute carrier family 22 member 18
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
SLC22A18
Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG.
100 μL
Primary
Expected identity based on immunogen sequence: Guinea pig: 92%; Equine: 92%; Bovine: 85%; Mouse: 85%.
Human, Mouse, Rat, Bovine, Equine, Guinea Pig
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Rabbit
Affinity purified
RUO
5002
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.