AP3B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AP3B1
Conjugate
Unconjugated
Regulatory Status
RUO
Gene ID (Entrez)
8546
Immunogen
Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
Primary or Secondary
Primary
Molecular Weight of Antigen
121 kDa
Classification
Polyclonal
Host Species
Rabbit
Gene Alias
Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit
Gene Symbols
AP3B1
Isotype
IgG
Test Specificity
This product is specific to AP3B1.
Related Products
Description
- AP3B1 Polyclonal specifically detects AP3B1 in Rat samples
- It is validated for Western Blot, Immunoprecipitation.
Compare Similar Items
Show Difference
Antigen: AP3B1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 8546
Immunogen: Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
Primary or Secondary: Primary
Molecular Weight of Antigen: 121 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit
Gene Symbols: AP3B1
Isotype: IgG
Test Specificity: This product is specific to AP3B1.
Antigen: ZEB1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 6935
Immunogen: Synthetic peptides corresponding to ZEB1 (zinc finger E-box binding homeobox 1) The peptide sequence was selected from the N terminal of ZEB1. Peptide sequence NPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPT.
Primary or Secondary: Primary
Molecular Weight of Antigen: 124 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
Gene Symbols: ZEB1
Isotype: IgG
Test Specificity: __
Antigen: __
Conjugate: __
Regulatory Status: __
Gene ID (Entrez): __
Immunogen: __
Primary or Secondary: __
Molecular Weight of Antigen: __
Classification: __
Host Species: __
Gene Alias: __
Gene Symbols: __
Isotype: __
Test Specificity: __
