SGLT2/SLC5A2 Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SGLT2/SLC5A2
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Apoptosis, Cancer, Tumor Suppressors
Formulation
PBS, 50% glycerol, pH7.3
Gene ID (Entrez)
6524
Isotype
IgG
Purification Method
Affinity purified
Dilution
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS
Primary or Secondary
Primary
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Related Products
Description
- Description SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: SGLT2/SLC5A2
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Apoptosis, Cancer, Tumor Suppressors
Formulation: PBS, 50% glycerol, pH7.3
Gene ID (Entrez): 6524
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: SARS-CoV-2 nsp2
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Infections (Virus Bacteria and Parasites)
Formulation: PBS, 50% glycerol, pH7.3
Gene ID (Entrez): 43740578
Isotype: IgG
Purification Method: Affinity purified
Dilution: __
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: SARS-CoV-2
Gene Alias: Non-structural protein 2, NSP2, p65 homolog
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1).
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: SARS-CoV-2 nsp4
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Infections (Virus Bacteria and Parasites)
Formulation: PBS, 50% glycerol, pH7.3
Gene ID (Entrez): 43740578
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500 - 1:2000
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: SARS-CoV-2
Gene Alias: Corona_NSP4_C, Coronavirus nonstructural protein 4 C-terminus, Non-structural protein 4, nsp4
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 399-499 of coronavirus NSP4 (YP_009725300.1). KRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVL
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
