SGLT2/SLC5A2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB429575-Each-of-1 | In Stock | ₹ 35,635.74 |
NB429575 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 35,635.74
GST (18%): ₹ 6,414.433
Total Price: ₹ 42,050.173
Antigen
SGLT2/SLC5A2
Classification
Polyclonal
Dilution
Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias
Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
SLC5A2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
Quantity
25 μL
Research Discipline
Apoptosis, Cancer, Tumor Suppressors
Gene ID (Entrez)
6524
Target Species
Human, Mouse, Canine
Isotype
IgG
Related Products
Description
- Description SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Canine samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Compare Similar Items
Show Difference
Antigen: SGLT2/SLC5A2
Classification: Polyclonal
Dilution: Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SLC5A2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
Quantity: 25 μL
Research Discipline: Apoptosis, Cancer, Tumor Suppressors
Gene ID (Entrez): 6524
Target Species: Human, Mouse, Canine
Isotype: IgG
Antigen: SFRS7
Classification: Polyclonal
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: AAG3, aging-associated protein 3, arginine/serine-rich 7, 35kDa, HSSG1, RBM37, serine/arginine-rich splicing factor 7, SFRS7ZCRB2,9G8, Splicing factor 9G8, Splicing factor, arginine/serine-rich 7, splicing factor, arginine/serine-rich 7 (35kD), SR splicing factor 7, ZCCHC20
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SRSF7
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGE
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 6432
Target Species: Human
Isotype: IgG
Antigen: RPL7L1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias: dJ475N16.4,60S ribosomal protein L7-like 1, MGC62004, ribosomal protein L7-like 1
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry/Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol
Gene Symbols: __
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGLRFKRLESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLV
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 285855
Target Species: Human
Isotype: IgG
