PI 3-Kinase p85 alpha Rabbit anti-Human, Mouse, Rat, Clone: 7Z9H0, Novus Biologicals™
Rabbit Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PI 3-Kinase p85 alpha
Dilution
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Primary or Secondary
Primary
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Clone
7Z9H0
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Formulation
PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)
5295
Isotype
IgG
Purification Method
Affinity purified
Related Products
Description
- PI 3-Kinase p85 alpha Monoclonal antibody specifically detects PI 3-Kinase p85 alpha in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: PI 3-Kinase p85 alpha
Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 7Z9H0
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 5295
Isotype: IgG
Purification Method: Affinity purified
Antigen: Lamin B2
Dilution: Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 to 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: lamin B2, lamin-B2, LMN2LAMB2, MGC2721
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 521-620 of human Lamin B2 (Q03252).
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 1S9M6
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Apoptosis, Cell Biology, Cytoskeleton Markers
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 84823
Isotype: IgG
Purification Method: Affinity purified
Antigen: Lamin B2
Dilution: Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 to 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: lamin B2, lamin-B2, LMN2LAMB2, MGC2721
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 521-620 of human Lamin B2 (Q03252).
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 1S9M6
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Apoptosis, Cell Biology, Cytoskeleton Markers
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 84823
Isotype: IgG
Purification Method: Affinity purified
