PI 3-Kinase p85 alpha Rabbit anti-Human, Mouse, Rat, Clone: 7Z9H0, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB168141-Each-of-1 | In Stock | ₹ 42,138.30 |
NB168141 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,138.30
GST (18%): ₹ 7,584.894
Total Price: ₹ 49,723.194
Antigen
PI 3-Kinase p85 alpha
Classification
Monoclonal
Conjugate
Unconjugated
Formulation
PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Purified
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone
7Z9H0
Dilution
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Alias
AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Quantity
100 μg
Research Discipline
Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Gene ID (Entrez)
5295
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- PI 3-Kinase p85 alpha Monoclonal antibody specifically detects PI 3-Kinase p85 alpha in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: PI 3-Kinase p85 alpha
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: 7Z9H0
Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Alias: AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Quantity: 100 μg
Research Discipline: Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Gene ID (Entrez): 5295
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: PI 3-Kinase p85 alpha
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: 7Z9H0
Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Alias: AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Quantity: 20 μg
Research Discipline: Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Gene ID (Entrez): 5295
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: Lamin B2
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone: 1S9M6
Dilution: Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 to 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias: lamin B2, lamin-B2, LMN2LAMB2, MGC2721
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 521-620 of human Lamin B2 (Q03252).
Quantity: 100 μg
Research Discipline: Apoptosis, Cell Biology, Cytoskeleton Markers
Gene ID (Entrez): 84823
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG