MHC Class I Antibody (ERMP42) - BSA Free, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB12015680-Each-of-1 | In Stock | ₹ 33,496.74 |
NB12015680 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 33,496.74
GST (18%): ₹ 6,029.413
Total Price: ₹ 39,526.153
Antigen
MHC Class I
Classification
Monoclonal
Concentration
1.0 mg/mL
Dilution
Flow Cytometry 1:100-1:200, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Gene Symbols
HLA-E
Immunogen
Balb/c macrophage precursor cell hybrids.
Quantity
0.05 mg
Research Discipline
Adaptive Immunity, Immunology, Major Histocompatibility Complexes
Gene ID (Entrez)
3133
Target Species
Mouse
Form
Purified
Applications
Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Frozen)
Clone
ERMP42
Conjugate
Unconjugated
Gene Alias
DKFZp686P19218, EA1.2, EA2.1, HLA class I histocompatibility antigen, alpha chain E, HLA class I histocompatibility antigen, E alpha chain, HLA-6.2, HLAE, lymphocyte antigen, major histocompatibility complex, class I, E, MHC, MHC class I antigen E, MHC HLA-E alpha-1, MHC HLA-E alpha-2.1, QA1
Host Species
Rat
Purification Method
Protein A or G purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
NB120-15680 recognizes a polymorphic determinant on the murine MHC (major histocompatibility complex) class I molecule. In the mouse, the MHC class I molecule is expressed on the cell surface of all nucleated cells but expression levels may differ according to cell type. Clone ER-MP42 specifically recognizes mouse strains with the haplotypes H-2Kv, H-2Dd and H-2k,q,s. Mouse strains with the haplotypes H-2p,r,w7,w22 show weak reactivity with this antibody.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG2a
Related Products
Description
- MHC Class I Monoclonal specifically detects MHC Class I in Mouse samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: MHC Class I
Classification: Monoclonal
Concentration: 1.0 mg/mL
Dilution: Flow Cytometry 1:100-1:200, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Gene Symbols: HLA-E
Immunogen: Balb/c macrophage precursor cell hybrids.
Quantity: 0.05 mg
Research Discipline: Adaptive Immunity, Immunology, Major Histocompatibility Complexes
Gene ID (Entrez): 3133
Target Species: Mouse
Form: Purified
Applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Frozen)
Clone: ERMP42
Conjugate: Unconjugated
Gene Alias: DKFZp686P19218, EA1.2, EA2.1, HLA class I histocompatibility antigen, alpha chain E, HLA class I histocompatibility antigen, E alpha chain, HLA-6.2, HLAE, lymphocyte antigen, major histocompatibility complex, class I, E, MHC, MHC class I antigen E, MHC HLA-E alpha-1, MHC HLA-E alpha-2.1, QA1
Host Species: Rat
Purification Method: Protein A or G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: NB120-15680 recognizes a polymorphic determinant on the murine MHC (major histocompatibility complex) class I molecule. In the mouse, the MHC class I molecule is expressed on the cell surface of all nucleated cells but expression levels may differ according to cell type. Clone ER-MP42 specifically recognizes mouse strains with the haplotypes H-2Kv, H-2Dd and H-2k,q,s. Mouse strains with the haplotypes H-2p,r,w7,w22 show weak reactivity with this antibody.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG2a
Antigen: alpha-1B Adrenergic R/ADRA1B
Classification: Polyclonal
Concentration: 1.0 mg/mL
Dilution: Western Blot, Flow (Cell Surface)
Gene Symbols: ADRA1B
Immunogen: Synthetic peptide, corresponding to amino acids 200-299 of Human Alpha 1b Adrenergic Receptor.
Quantity: 0.05 mg
Research Discipline: GPCR, Neuroscience
Gene ID (Entrez): 147
Target Species: Human
Form: __
Applications: Western Blot, Flow Cytometry
Clone: __
Conjugate: Unconjugated
Gene Alias: ADRA1, adrenergic, alpha-1B-, receptor, alpha-1B adrenergic receptor, Alpha-1B adrenoceptor, Alpha-1B adrenoreceptor, alpha-1B-adrenergic receptor, ALPHA1BAR
Host Species: Chicken
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Alpha 1b Adrenergic Receptor
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: __
Antigen: ROD1
Classification: Polyclonal
Concentration: __
Dilution: Western Blot 1.0 ug/ml
Gene Symbols: __
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ROD1 (NP_659153.2). Peptide sequence QRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNF
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 9991
Target Species: Mouse
Form: Purified
Applications: Western Blot
Clone: __
Conjugate: Unconjugated
Gene Alias: DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: __
