Classification:
Polyclonal
Dilution:
Western Blot 1.0 ug/ml
Gene Alias:
DKFZp686L12190, EC 1.14.11, EC 1.14.11.-, histone demethylase UTY, tetratricopeptide repeat protein, ubiquitous TPR motif protein UTY, ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome, ubiquitously transcribed tetratricopeptide repeat gene, Y-linked, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 101, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 106, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 11, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 118, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 121, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 132, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 133, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 136, ubiquitou
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human UTY (NP_009056). Peptide sequence LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKA
Primary or Secondary:
Primary
Applications:
Western Blot
Formulation:
PBS buffer, 2% sucrose
Purification Method:
Affinity purified
Content And Storage:
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.