UTY Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB120177-Each-of-1 | In Stock | ₹ 41,710.50 |
NB120177 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
UTY
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
DKFZp686L12190, EC 1.14.11, EC 1.14.11.-, histone demethylase UTY, tetratricopeptide repeat protein, ubiquitous TPR motif protein UTY, ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome, ubiquitously transcribed tetratricopeptide repeat gene, Y-linked, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 101, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 106, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 11, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 118, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 121, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 132, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 133, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 136, ubiquitou
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UTY (NP_009056). Peptide sequence LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKA
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
7404
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- UTY Polyclonal specifically detects UTY in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: UTY
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: DKFZp686L12190, EC 1.14.11, EC 1.14.11.-, histone demethylase UTY, tetratricopeptide repeat protein, ubiquitous TPR motif protein UTY, ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome, ubiquitously transcribed tetratricopeptide repeat gene, Y-linked, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 101, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 106, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 11, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 118, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 121, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 132, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 133, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 136, ubiquitou
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UTY (NP_009056). Peptide sequence LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKA
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 7404
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: CATSPER3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Ca(v)-like protein, CACRC, calcium channel repeat containing 1, cation channel sperm-associated protein 3, cation channel, sperm associated 3, CatSper3, MGC126741, One-repeat calcium channel-like protein, putative ion channel CatSper3
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CATSPER3 (NP_821138.1).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 347732
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: Serpin G1/C1 Inhibitor
Classification: Polyclonal
Dilution: Western Blot, ELISA
Gene Alias: C1IN, C1INH, C1NH, HAE1, HAE2, SERPING1 serpin peptidase inhibitor, clade G (C1 inhibitor), member 1
Immunogen: Human Serpin G1/C1 Inhibitor
Quantity: 1 mg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot, ELISA
Conjugate: Unconjugated
Formulation: 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7
Host Species: Sheep
Purification Method: >95%, by SDS-PAGE
Regulatory Status: RUO
Gene ID (Entrez): 710
Content And Storage: Store at 4°C.