ILT11/LILRA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB123939-Each-of-1 | In Stock | ₹ 41,710.50 |
NB123939 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
ILT11/LILRA5
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
CD85, CD85 antigen-like family member F, CD85F, CD85f antigen, ILT-11, ILT11CD85f, Immunoglobulin-like transcript 11, leukocyte Ig-like receptor 9, Leukocyte immunoglobulin-like receptor 9, leukocyte immunoglobulin-like receptor subfamily A member 5, leukocyte immunoglobulin-like receptor subfamily A member 5 soluble, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LILRB7, LIR-9, LIR9immunoglobulin-like transcript 11 protein, member 7
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ILT11/LILRA5 (NP_870994). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
353514
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ILT11/LILRA5 Polyclonal specifically detects ILT11/LILRA5 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ILT11/LILRA5
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: CD85, CD85 antigen-like family member F, CD85F, CD85f antigen, ILT-11, ILT11CD85f, Immunoglobulin-like transcript 11, leukocyte Ig-like receptor 9, Leukocyte immunoglobulin-like receptor 9, leukocyte immunoglobulin-like receptor subfamily A member 5, leukocyte immunoglobulin-like receptor subfamily A member 5 soluble, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LILRB7, LIR-9, LIR9immunoglobulin-like transcript 11 protein, member 7
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ILT11/LILRA5 (NP_870994). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 353514
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: LINGO-2
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: LERN3FLJ31810, leucine rich repeat and Ig domain containing 2, leucine-rich repeat and immunoglobulin-like domain-containing nogoreceptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C, LRRN6Cleucine rich repeat neuronal 6C
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse LINGO-2 (NP_780725). Peptide sequence KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 158038
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: LINGO-2
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: LERN3FLJ31810, leucine rich repeat and Ig domain containing 2, leucine-rich repeat and immunoglobulin-like domain-containing nogoreceptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C, LRRN6Cleucine rich repeat neuronal 6C
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LINGO-2 (NP_689783). Peptide sequence ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 158038
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
