KIR2DS4/CD158i Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB124853-Each-of-1 | In Stock | ₹ 41,710.50 |
NB124853 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
KIR2DS4/CD158i
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
CD158 antigen-like family member I, CD158I, CD158i antigen, cl-39, killer cell immunoglobulin-like receptor 2DS4, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail4,nkat8, killer inhibitory receptor 4-1-2, KIR antigen 2DS4, KKA3KIR1D, MGC120019, MGC125315, MGC125317, MHC class I NK cell receptor, natural killer cell inhibitory receptor, Natural killer-associated transcript 8, NKAT-8, NKAT8KIR412, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17
Immunogen
The immunogen for Anti-KIR2DS4/CD158i antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4 (NP_036446.3). Peptide sequence RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
3809
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- KIR2DS4/CD158i Polyclonal specifically detects KIR2DS4/CD158i in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: KIR2DS4/CD158i
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: CD158 antigen-like family member I, CD158I, CD158i antigen, cl-39, killer cell immunoglobulin-like receptor 2DS4, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail4,nkat8, killer inhibitory receptor 4-1-2, KIR antigen 2DS4, KKA3KIR1D, MGC120019, MGC125315, MGC125317, MHC class I NK cell receptor, natural killer cell inhibitory receptor, Natural killer-associated transcript 8, NKAT-8, NKAT8KIR412, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17
Immunogen: The immunogen for Anti-KIR2DS4/CD158i antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4 (NP_036446.3). Peptide sequence RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 3809
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: KIR3DL2/CD158k
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: killer cell immunoglobulin-like receptor 3DL2, CD158K, killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2, NKAT4, NKAT-4, NKAT4B, p140
Immunogen: The immunogen for Anti-KIR3DL2/CD158k antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2 (NP_006728.2). Peptide sequence IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 3812
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: Neuronal Pentraxin 1
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: DKFZp686J2446, MGC105123, neuronal pentraxin INP1NP-I, neuronal pentraxin-1
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Neuronal Pentraxin 1 (NP_002513.2). Peptide sequence DTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKV
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 4884
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
