TXNDC12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB124937-Each-of-1 | In Stock | ₹ 41,710.50 |
NB124937 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
TXNDC12
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
AG1, AGR1, anterior gradient homolog 1, EC 1.8.4.2, endoplasmic reticulum protein ERp19, Endoplasmic reticulum resident protein 18, Endoplasmic reticulum resident protein 19, endoplasmic reticulum thioredoxin superfamily member, 18 kDa, ER protein 18, ER protein 19, ERP16, ERp18, ERP18AG1, ERP19, hAG-1, hTLP19, PDIA16, protein disulfide isomerase family A, member 16, thioredoxin domain containing 12 (endoplasmic reticulum), thioredoxin domain-containing protein 12, Thioredoxin-like protein p19, TLP19, TLP19hTLP19, TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC12 (NP_056997). Peptide sequence METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
51060
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TXNDC12 Polyclonal specifically detects TXNDC12 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: TXNDC12
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: AG1, AGR1, anterior gradient homolog 1, EC 1.8.4.2, endoplasmic reticulum protein ERp19, Endoplasmic reticulum resident protein 18, Endoplasmic reticulum resident protein 19, endoplasmic reticulum thioredoxin superfamily member, 18 kDa, ER protein 18, ER protein 19, ERP16, ERp18, ERP18AG1, ERP19, hAG-1, hTLP19, PDIA16, protein disulfide isomerase family A, member 16, thioredoxin domain containing 12 (endoplasmic reticulum), thioredoxin domain-containing protein 12, Thioredoxin-like protein p19, TLP19, TLP19hTLP19, TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC12 (NP_056997). Peptide sequence METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 51060
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SLC39A13
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: FLJ25785, LIV-1 subfamily of ZIP zinc transporter 9, LZT-Hs9, solute carrier family 39 (metal ion transporter), member 13, solute carrier family 39 (zinc transporter), member 13, Solute carrier family 39 member 13, zinc transporter ZIP13, ZIP13, ZIP-13, Zrt- and Irt-like protein 13
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC39A13 (NP_001121697.1). Peptide sequence GGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAA
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 91252
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: HDHD1A
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 8226
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
