ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB124987-Each-of-1 | In Stock | ₹ 42,737.22 |
NB124987 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
Alpha-2,8-sialyltransferase 8A, alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, disialoganglioside (GD3) synthase, Ganglioside GD3 synthase, Ganglioside GT3 synthase, ganglioside-specific alpha-2,8-polysialyltransferase, GD3 synthase), GD3S, sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3synthase) A, Sialyltransferase 8A, sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, Sialytransferase St8Sia I, SIAT8A, SIAT8-A, SIAT8EC 2.4.99.8, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, ST8SiaI
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 (NP_003025.1). Peptide sequence RKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQA
Quantity
100 μg
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
6489
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Alpha-2,8-sialyltransferase 8A, alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, disialoganglioside (GD3) synthase, Ganglioside GD3 synthase, Ganglioside GT3 synthase, ganglioside-specific alpha-2,8-polysialyltransferase, GD3 synthase), GD3S, sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3synthase) A, Sialyltransferase 8A, sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, Sialytransferase St8Sia I, SIAT8A, SIAT8-A, SIAT8EC 2.4.99.8, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, ST8SiaI
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 (NP_003025.1). Peptide sequence RKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQA
Quantity: 100 μg
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 6489
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: SPG21
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Acid cluster protein 33, ACP33Spastic paraplegia 21 protein, GL010, MASPARDIN, MASTBM-019, spastic paraplegia 21 (autosomal recessive, Mast syndrome), Spastic paraplegia 21 autosomal recessive Mast syndrome protein
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of Human SPG21 (NP_001121361.1). Peptide sequence GTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQIL
Quantity: 100 μg
Research Discipline: Neurodegeneration
Gene ID (Entrez): 51324
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Syntaxin 7
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: syntaxin 7, syntaxin-7
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Syntaxin 7 (NP_003560.2). Peptide sequence YIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEF
Quantity: 100 μg
Research Discipline: Endosome Markers
Gene ID (Entrez): 8417
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
