LPCAT3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125049-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125049 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
LPCAT3
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, C3F, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.n6, LPCAT, LPLAT 5, Lyso-PC acyltransferase, Lyso-PC acyltransferase 3, Lysophosphatidylcholine acyltransferase, lysophosphatidylcholine acyltransferase 3LPSAT, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 5, Lyso-PS acyltransferase, MBOAT5OACT5, membrane bound O-acyltransferase domain containing 5, Membrane-bound O-acyltransferase domain-containing protein 5, nessy, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing protein 5, putative protein similar to nessy
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LPCAT3 (NP_005759.4). Peptide sequence TVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
10162
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- LPCAT3 Polyclonal specifically detects LPCAT3 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: LPCAT3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: 1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, C3F, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.n6, LPCAT, LPLAT 5, Lyso-PC acyltransferase, Lyso-PC acyltransferase 3, Lysophosphatidylcholine acyltransferase, lysophosphatidylcholine acyltransferase 3LPSAT, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 5, Lyso-PS acyltransferase, MBOAT5OACT5, membrane bound O-acyltransferase domain containing 5, Membrane-bound O-acyltransferase domain-containing protein 5, nessy, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing protein 5, putative protein similar to nessy
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPCAT3 (NP_005759.4). Peptide sequence TVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10162
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: GPR12
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: FLJ18149, FLJ97704, G protein-coupled receptor 12, GPCR12, GPCR21, G-protein coupled receptor 12, MGC138349, MGC138351
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPR12 (NP_005279.1). Peptide sequence DLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCT
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 2835
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: RCAN3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Down syndrome candidate region 1-like 2, Down syndrome critical region gene 1-like 2, DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5, hRCN3, Myocyte-enriched calcineurin-interacting protein 3, RCAN family member 3, RCN3, Regulator of calcineurin 3, regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2, regulator of calcineurin 3 isoform 1b2,34,5, regulator of calcineurin 3 isoform 1c2,34,5, regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCAN3 (NP_001238906.1). Peptide sequence QKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDAM
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 11123
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
