XPB Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125105-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125105 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
XPB
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human XPB (NP_000113.1). Peptide sequence KRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTK
Quantity
100 μg
Research Discipline
Cancer, DNA Repair, Nucleotide Excision Repair
Gene ID (Entrez)
2071
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- XPB Polyclonal specifically detects XPB in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: XPB
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XPB (NP_000113.1). Peptide sequence KRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTK
Quantity: 100 μg
Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
Gene ID (Entrez): 2071
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Histidase
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: EC 4.3.1, EC 4.3.1.3, HIS, Histidase, histidine ammonia-lyase, HSTD
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Histidase (NP_034531.1). Peptide sequence VRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEAFNAS
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 3034
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Antigen: Secretin
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: secretin
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of rat Secretin (NP_073161). Peptide sequence SFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENI
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 6343
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Rat
Form: Purified
