HSD3B1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125307-Each-of-1 | In Stock | ₹ 42,737.22 |
NB125307 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
HSD3B1
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HSD3B1 (NP_001155214.1). Peptide sequence DIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCAL
Quantity
100 μg
Research Discipline
Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction
Gene ID (Entrez)
3283
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Mouse
Form
Purified
Related Products
Description
- HSD3B1 Polyclonal specifically detects HSD3B1 in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: HSD3B1
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HSD3B1 (NP_001155214.1). Peptide sequence DIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCAL
Quantity: 100 μg
Research Discipline: Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction
Gene ID (Entrez): 3283
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Antigen: SPNS3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: MGC29671, protein spinster homolog 3, spinster homolog 3 (Drosophila)
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SPNS3 (NP_084208.1). Peptide sequence RGTAEALQITVAHVLGDAGSPYLTGLISSVLQAERPDSYLQHFLSLQHSF
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 201305
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Antigen: MS4A8A
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: 2010004L09Rik, AI481240, CD20 antigen-like 5, CD20L, CD20L5, membrane-spanning 4-domains subfamily A member 8, Ms4, MS4A8, MS4a8B protein
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse MS4A8A (NP_071875.2). Peptide sequence VSSHFGCQVACCHYNNPGVVIPNVYAANPVVIPEPPNPIPSYSEVVQDSR
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 64381
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
