MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125589-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125589 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
MBD4
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Gene Alias
EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_003916). Peptide sequence CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Quantity
100 μg
Research Discipline
Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
Gene ID (Entrez)
8930
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
ChIP Assay
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- MBD4 Polyclonal specifically detects MBD4 in Human samples
- It is validated for Western Blot, Chromatin Immunoprecipitation.
Compare Similar Items
Show Difference
Antigen: MBD4
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Gene Alias: EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_003916). Peptide sequence CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Quantity: 100 μg
Research Discipline: Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
Gene ID (Entrez): 8930
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: ChIP Assay
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: TRIM14
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: KIAA0129tripartite motif-containing 14, tripartite motif containing 14, tripartite motif protein TRIM14, tripartite motif-containing protein 14
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM14 (NP_150090). Peptide sequence SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP
Quantity: 100 μg
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 9830
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: RNF113B
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: bA10G5.1, MGC26599, ring finger protein 113B, Zinc finger protein 183-like 1RNF161ZNF183L1
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF113B (NP_849192). Peptide sequence MGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYL
Quantity: 100 μg
Research Discipline: Zinc Finger
Gene ID (Entrez): 140432
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
