BAFF/BLyS/TNFSF13B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB239317-Each-of-1 | In Stock | ₹ 46,801.32 |
NB239317 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 46,801.32
GST (18%): ₹ 8,424.238
Total Price: ₹ 55,225.558
Antigen
BAFF/BLyS/TNFSF13B
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias
ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Quantity
100 μg
Research Discipline
Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Gene ID (Entrez)
10673
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- BAFF/BLyS/TNFSF13B Polyclonal antibody specifically detects BAFF/BLyS/TNFSF13B in Human samples
- It is validated for Immunofluorescence
Compare Similar Items
Show Difference
Antigen: BAFF/BLyS/TNFSF13B
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Quantity: 100 μg
Research Discipline: Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Gene ID (Entrez): 10673
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: SAP30
Classification: Polyclonal
Dilution: Western Blot
Gene Alias: 30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kDa
Immunogen: The immunogen this antibody was made to, maps to a region between residue 170 and 220 of human Sin3A-Associated Protein, 30kDa using the numbering given in entry NP_003855.1 (GeneID 8819).
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 8819
Content And Storage: Store at 4C in the dark.
Isotype: IgG
Applications: Western Blot
Conjugate: Alexa Fluor 750
Formulation: 50mM Sodium Borate
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse
Form: Purified
Antigen: BAFF/BLyS/TNFSF13B
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Quantity: 25 μg
Research Discipline: Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Gene ID (Entrez): 10673
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
