BAFF/BLyS/TNFSF13B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB239320-Each-of-1 | In Stock | ₹ 28,234.80 |
NB239320 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 28,234.80
GST (18%): ₹ 5,082.264
Total Price: ₹ 33,317.064
Antigen
BAFF/BLyS/TNFSF13B
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias
ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Quantity
25 μg
Research Discipline
Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Gene ID (Entrez)
10673
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- BAFF/BLyS/TNFSF13B Polyclonal antibody specifically detects BAFF/BLyS/TNFSF13B in Human samples
- It is validated for Immunofluorescence
Compare Similar Items
Show Difference
Antigen: BAFF/BLyS/TNFSF13B
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Quantity: 25 μg
Research Discipline: Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Gene ID (Entrez): 10673
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: CCDC18
Classification: Polyclonal
Dilution: Western Blot
Gene Alias: coiled-coil domain containing 18, coiled-coil domain-containing protein 18, dJ717I23.1, NY-SAR-41, sarcoma antigen NY-SAR-41
Immunogen: The immunogen for this product maps to a region between residue 225 and 275 of human Coiled-Coil Domain Containing 18 using the numbering given in entry CAI22508.1 (GeneID 343099).
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 343099
Content And Storage: Store at 4C in the dark.
Isotype: IgG
Applications: Western Blot
Conjugate: Janelia Fluor 549
Formulation: 50mM Sodium Borate
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: CDC40
Classification: Polyclonal
Dilution: Western Blot
Gene Alias: Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF17FLJ10564
Immunogen: The immunogen this antibody was made to, maps to a region between residue 175 and 225 of human Cell Division Cycle 40 using the numbering given in entry NP_056975.1 (GeneID 51362).
Quantity: 0.1 mL
Research Discipline: Cancer, Cell Biology, Cell Cycle and Replication
Gene ID (Entrez): 51362
Content And Storage: Store at 4C in the dark.
Isotype: IgG
Applications: Western Blot
Conjugate: DyLight 680
Formulation: 50mM Sodium Borate
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
