LRPAP Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB301491-Each-of-1 | In Stock | ₹ 45,731.82 |
NB301491 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,731.82
GST (18%): ₹ 8,231.728
Total Price: ₹ 53,963.548
Antigen
LRPAP
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias
A2MRAPMRAP, A2RAP, alpha-2-macroglobulin receptor-associated protein, alpha-2-macroglobulin receptor-associated protein 1, Alpha-2-MRAP, HBP44, lipoprotein receptor associated protein, low density lipoprotein receptor-related protein associated protein 1, Low density lipoprotein receptor-related protein-associated protein 1, low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1), MGC138272, RAP
Immunogen
This antibody has been engineered to specifically recognize the recombinant protein LRPAP using the following amino acid sequence: ANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
Quantity
100 μL
Research Discipline
Cellular Signaling
Gene ID (Entrez)
4043
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunocytochemistry
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- LRPAP Polyclonal antibody specifically detects LRPAP in Human samples
- It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Compare Similar Items
Show Difference
Antigen: LRPAP
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: A2MRAPMRAP, A2RAP, alpha-2-macroglobulin receptor-associated protein, alpha-2-macroglobulin receptor-associated protein 1, Alpha-2-MRAP, HBP44, lipoprotein receptor associated protein, low density lipoprotein receptor-related protein associated protein 1, Low density lipoprotein receptor-related protein-associated protein 1, low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1), MGC138272, RAP
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein LRPAP using the following amino acid sequence: ANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
Quantity: 100 μL
Research Discipline: Cellular Signaling
Gene ID (Entrez): 4043
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: LONRF2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: FLJ45273, LON peptidase N-terminal domain and ring finger 2, LON peptidase N-terminal domain and RING finger protein 2, MGC126711, Neuroblastoma apoptosis-related protease, RING finger protein 192, RNF192MGC126713
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein LONRF2 using the following amino acid sequence: GHSHMNAQALLEEGDAGSSENSSEKSDMLGNTNSSVLYFILGLHFEEDKKALESILPTAPSAGLKRQFPDDVEDAPDLNAPGKIPKKDLSLQRSPN
Quantity: 100 μL
Research Discipline: Zinc Finger
Gene ID (Entrez): 164832
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: LMX1b
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: LIM homeobox transcription factor 1, beta, LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1.2, LMX-1.2, MGC138325, MGC142051, NPS1
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein LMX1b using the following amino acid sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG
Quantity: 100 μL
Research Discipline: Neuroscience
Gene ID (Entrez): 4010
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
