Clusterin/APOJ Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB301703-Each-of-1 | In Stock | ₹ 45,731.82 |
NB301703 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,731.82
GST (18%): ₹ 8,231.728
Total Price: ₹ 53,963.548
Antigen
Clusterin/APOJ
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias
40, 40, sulfated glycoprotein 2, Aging-associated gene 4 protein, aging-associated protein 4, apo-J, APOJ, Apolipoprotein J, CLIclusterin (complement lysis inhibitor, SP-40, clusterin, Complement cytolysis inhibitor, complement lysis inhibitor, Complement-associated protein SP-40, Ku70-binding protein 1, KUB1SGP2, MGC24903, NA1/NA2, SGP-2, SP-40, sulfated glycoprotein 2, Testosterone-repressed prostate message 2, testosterone-repressed prostate message 2, apolipoprotein J), TRPM-2TRPM2
Immunogen
This antibody has been engineered to specifically recognize the recombinant protein Clusterin/APOJ using the following amino acid sequence: KEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDH
Quantity
100 μL
Research Discipline
Apoptosis, Cancer, Cardiovascular Biology, Cytokine Research, Dendritic Cell Markers, Hypoxia, Immunology, Innate Immunity
Gene ID (Entrez)
1191
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunocytochemistry
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- Clusterin/APOJ Polyclonal antibody specifically detects Clusterin/APOJ in Human samples
- It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Compare Similar Items
Show Difference
Antigen: Clusterin/APOJ
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: 40, 40, sulfated glycoprotein 2, Aging-associated gene 4 protein, aging-associated protein 4, apo-J, APOJ, Apolipoprotein J, CLIclusterin (complement lysis inhibitor, SP-40, clusterin, Complement cytolysis inhibitor, complement lysis inhibitor, Complement-associated protein SP-40, Ku70-binding protein 1, KUB1SGP2, MGC24903, NA1/NA2, SGP-2, SP-40, sulfated glycoprotein 2, Testosterone-repressed prostate message 2, testosterone-repressed prostate message 2, apolipoprotein J), TRPM-2TRPM2
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Clusterin/APOJ using the following amino acid sequence: KEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDH
Quantity: 100 μL
Research Discipline: Apoptosis, Cancer, Cardiovascular Biology, Cytokine Research, Dendritic Cell Markers, Hypoxia, Immunology, Innate Immunity
Gene ID (Entrez): 1191
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: CLEC-2/CLEC-1B
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: 1810061I13Rik, CLEC-2, CLEC2B, CLEC2PRO1384, C-type lectin domain family 1 member B, C-type lectin domain family 1, member B, C-type lectin-like receptor 2, C-type lectin-like receptor-2, QDED721
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CLEC-2/CLEC-1B using the following amino acid sequence: WSVMQRNYLQDENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESK
Quantity: 100 μL
Research Discipline: Immunology, Innate Immunity, Signal Transduction
Gene ID (Entrez): 51266
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Claudin-20
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: claudin 20, claudin-20
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Claudin-20 using the following amino acid sequence: WYTKEIIANFLDLTVPESNKHEPG
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 49861
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
