SCAF11/SFRS2IP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB395071-Each-of-1 | In Stock | ₹ 32,683.92 |
NB395071 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
SCAF11/SFRS2IP
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias
CASP11Splicing regulatory protein 129, Renal carcinoma antigen NY-REN-40, serine/arginine-rich splicing factor 2, interacting protein, Serine/arginine-rich splicing factor 2-interacting protein, SFRS2-interacting protein, SFRS2IPSC35-interacting protein 1, SIP1SRSF2IP, splicing factor, arginine/serine-rich 2, interacting protein, Splicing factor, arginine/serine-rich 2-interacting protein, SR-related and CTD-associated factor 11, SR-related CTD-associated factor 11, SRrp129, SRRP129CTD-associated SR protein 11, SRSF2-interacting protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SCAF11
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ
Quantity
25 μL
Research Discipline
Apoptosis, Cancer, Caspases
Gene ID (Entrez)
9169
Target Species
Human
Isotype
IgG
Related Products
Description
- Description SCAF11/SFRS2IP Polyclonal specifically detects SCAF11/SFRS2IP in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SCAF11/SFRS2IP
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias: CASP11Splicing regulatory protein 129, Renal carcinoma antigen NY-REN-40, serine/arginine-rich splicing factor 2, interacting protein, Serine/arginine-rich splicing factor 2-interacting protein, SFRS2-interacting protein, SFRS2IPSC35-interacting protein 1, SIP1SRSF2IP, splicing factor, arginine/serine-rich 2, interacting protein, Splicing factor, arginine/serine-rich 2-interacting protein, SR-related and CTD-associated factor 11, SR-related CTD-associated factor 11, SRrp129, SRRP129CTD-associated SR protein 11, SRSF2-interacting protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SCAF11
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ
Quantity: 25 μL
Research Discipline: Apoptosis, Cancer, Caspases
Gene ID (Entrez): 9169
Target Species: Human
Isotype: IgG
Antigen: NUDT14
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias: EC 3.6.1.45, Nucleoside diphosphate-linked moiety X motif 14, nudix (nucleoside diphosphate linked moiety X)-type motif 14, Nudix motif 14, UDPG pyrophosphatase, UDP-sugar diphosphatase, UGPPase, UGPPnucleoside diphosphate linked moiety X-type motif 14, uridine diphosphate glucose pyrophosphatase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NUDT14
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVAC
Quantity: 25 μL
Research Discipline: metabolism
Gene ID (Entrez): 256281
Target Species: Human
Isotype: IgG
Antigen: ZNF239
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias: KIAA1198, zinc finger protein 490
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZNF239
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDTQDSSVKFCKNEPQDHQESRRLFVMEESTERKVIKGESCSENLQVKLVSDGQELASPLLNGEATCQNGQL
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 8187
Target Species: Human
Isotype: IgG
