Solute carrier family 22 member 18 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB403736-Each-of-1 | In Stock | ₹ 32,683.92 |
NB403736 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
Solute carrier family 22 member 18
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5002
Target Species
Human
Form
Purified
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SLC22A18
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGLVIGQLSSHFSEEVLLR
Quantity
25 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype
IgG
Related Products
Description
- Solute carrier family 22 member 18 Polyclonal specifically detects Solute carrier family 22 member 18 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Solute carrier family 22 member 18
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5002
Target Species: Human
Form: Purified
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SLC22A18
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGLVIGQLSSHFSEEVLLR
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Antigen: GBX2
Classification: Polyclonal
Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: Gastrulation and brain-specific homeobox protein 2, gastrulation brain homeo box 2, gastrulation brain homeobox 2, homeobox protein GBX-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2637
Target Species: Human
Form: Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GBX2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Antigen: THAP1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: 4833431A01Rik, dystonia 6, torsion (autosomal dominant), DYT6, FLJ10477, MGC33014, nuclear proapoptotic factor, THAP domain containing, apoptosis associated protein 1, THAP domain protein 1, THAP domain-containing protein 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55145
Target Species: Human
Form: Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: THAP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
