TGN46 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB431585-Each-of-1 | In Stock | ₹ 35,635.74 |
NB431585 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 35,635.74
GST (18%): ₹ 6,414.433
Total Price: ₹ 42,050.173
Antigen
TGN46
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
TGN 46, TGN 48, TGN 51, TGN38, TGN-38, TGN38 homolog, TGN46, TGN-46, TGN48, TGN51, TGOLN 2, TGOLN2, trans golgi network 38, trans golgi network 46, Trans Golgi network integral membrane protein 2, Trans Golgi network integral membrane protein 2 [Precursor], Trans Golgi network protein (46 48 51kD isoforms), Trans golgi network protein 2, Trans Golgi network protein TGN51, Trans-Golgi network integral membrane protein 2, Trans-Golgi network protein 2, Trans-Golgi network protein TGN51, TTGN 2, TTGN2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
TGOLN2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNRSGA
Quantity
25 μL
Research Discipline
Golgi Apparatus Markers, Trans golgi Network Markers
Gene ID (Entrez)
10618
Target Species
Human
Isotype
IgG
Related Products
Description
- TGN46 Polyclonal specifically detects TGN46 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TGN46
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: TGN 46, TGN 48, TGN 51, TGN38, TGN-38, TGN38 homolog, TGN46, TGN-46, TGN48, TGN51, TGOLN 2, TGOLN2, trans golgi network 38, trans golgi network 46, Trans Golgi network integral membrane protein 2, Trans Golgi network integral membrane protein 2 [Precursor], Trans Golgi network protein (46 48 51kD isoforms), Trans golgi network protein 2, Trans Golgi network protein TGN51, Trans-Golgi network integral membrane protein 2, Trans-Golgi network protein 2, Trans-Golgi network protein TGN51, TTGN 2, TTGN2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TGOLN2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNRSGA
Quantity: 25 μL
Research Discipline: Golgi Apparatus Markers, Trans golgi Network Markers
Gene ID (Entrez): 10618
Target Species: Human
Isotype: IgG
Antigen: GPR137B
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: G protein-coupled receptor 137B, TM7SF1, transmembrane 7 superfamily member 1 (upregulated in kidney)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GPR137B
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG
Quantity: 25 μL
Research Discipline: GPCR
Gene ID (Entrez): 7107
Target Species: Human
Isotype: IgG
Antigen: TRIM67
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: FLJ44831, TNLTRIM9-like protein TNL, TRIM9-like protein, tripartite motif containing 67, tripartite motif-containing 67, tripartite motif-containing protein 67
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TRIM67
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAGAAAAASLEHDAAAGPACGGAGGSAA
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 440730
Target Species: Human
Isotype: IgG
