Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP154587-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP154587 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
PA28 Activator gamma Subunit/PSME3
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
11S regulator complex gamma subunit, 11S regulator complex subunit gamma, Activator of multicatalytic protease subunit 3, Ki, Ki antigen, PA28g, PA28gamma, PA28-gamma, PA28GKi nuclear autoantigen, proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Proteasome activator 28 subunit gamma, proteasome activator 28-gamma, proteasome activator complex subunit 3, REG-gamma
Rabbit
31 kDa
100 μL
Core ESC Like Genes, Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers, Ubiquitin Proteasome Pathway
10197
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
P61289-2
PSME3
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PA28 Activator gamma Subunit/PSME3. Peptide Sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ. The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
RUO
Primary
This product is specific to Subunit or Isoform: 3.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG