BRICK1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156944-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP156944 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
BRICK1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
BRK1, Brk1-like, chromosome 3 open reading frame 10, hHBrk1, HSPC300, MDS027, probable protein BRICK1
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
55845
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
Q8WUW1
Gene Symbols
BRK1
Immunogen
Synthetic peptides corresponding to C3ORF10 The peptide sequence was selected from the middle region of C3ORF10. Peptide sequence YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Zebrafish: 100%; Human: 100%; Mouse: 100%; Xenopus: 100%; Channel catfish: 100%; Rat: 100%; Sablefish: 100%; Northern pike: 100%; Atlantic salmon: 100%; Western clawed frog: 100%; Bovine: 100%; Body louse: 92%; Black-legged tick: 92%; Harpegnathos saltator: 92%; Assassin bug: 92%; African malaria mosquito: 85%; Yellowfever mosquito: 85%; Savannah tsetse fly: 85%; Fruit fly: 85%; Southern house mosquito: 85%; Starlet sea anemone: 78%; Grape: 76%; Castor bean: 76%;.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Zebrafish
Form
Purified
Related Products
Description
- BRICK1 Polyclonal specifically detects BRICK1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: BRICK1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: BRK1, Brk1-like, chromosome 3 open reading frame 10, hHBrk1, HSPC300, MDS027, probable protein BRICK1
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 55845
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q8WUW1
Gene Symbols: BRK1
Immunogen: Synthetic peptides corresponding to C3ORF10 The peptide sequence was selected from the middle region of C3ORF10. Peptide sequence YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 100%; Human: 100%; Mouse: 100%; Xenopus: 100%; Channel catfish: 100%; Rat: 100%; Sablefish: 100%; Northern pike: 100%; Atlantic salmon: 100%; Western clawed frog: 100%; Bovine: 100%; Body louse: 92%; Black-legged tick: 92%; Harpegnathos saltator: 92%; Assassin bug: 92%; African malaria mosquito: 85%; Yellowfever mosquito: 85%; Savannah tsetse fly: 85%; Fruit fly: 85%; Southern house mosquito: 85%; Starlet sea anemone: 78%; Grape: 76%; Castor bean: 76%;.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Zebrafish
Form: Purified
Antigen: SFRS12
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DKFZp564B176, Serine/arginine-rich-splicing regulatory protein 86, SFRS12serine-arginine-rich-splicing regulatory protein 86, Splicing factor, arginine/serine-rich 12MGC133045, splicing regulatory glutamine/lysine-rich protein 1, Splicing regulatory protein 508, SRRp508, SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508, SRRP86
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 140890
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8WXA9-2
Gene Symbols: SREK1
Immunogen: Synthetic peptides corresponding to SFRS12(splicing factor, arginine/serine-rich 12) The peptide sequence was selected from the N terminal of SFRS12. Peptide sequence DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Zebrafish: 92%; Bovine: 92%; Green puffer: 92%; Mouse: 92%; Atlantic salmon: 84%;.
Target Species: Human, Mouse, Rat, Canine, Guinea Pig, Rabbit, Zebrafish
Form: __
Antigen: IQCD
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: 4933433C09Rik, IQ domain-containing protein D, IQ motif containing D
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 115811
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q96DY2
Gene Symbols: IQCD
Immunogen: Synthetic peptides corresponding to IQCD(IQ motif containing D) The peptide sequence was selected from the N terminal of IQCD. Peptide sequence ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
Target Species: Human
Form: __
