SFRS9 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157465-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157465 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
SFRS9
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
Pre-mRNA-splicing factor SRp30C, serine/arginine-rich splicing factor 9, SFRS9, Splicing factor, arginine/serine-rich 9SR splicing factor 9, SRp30c
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
8683
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry
Gene Accession No.
Q13242
Gene Symbols
SRSF9
Immunogen
Synthetic peptides corresponding to SFRS9(splicing factor, arginine/serine-rich 9) The peptide sequence was selected from the middle region of SFRS9. Peptide sequence VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence:Caenorhabditis briggsaeAF16: 100%;Caenorhabditis elegans: 100%; Western clawed frog: 100%; Xenopus: 100%; Rat: 100%; Mouse: 100%;Caenorhabditis vulgaris: 100%; Canine: 100%; Human: 100%; Zebrafish: 92%; Chicken: 92%; Sumatran orangutan: 92%; Green puffer: 92%; Pig: 92%; Eye worm: 92%; Atlantic salmon: 92%; Filarial nematode worm: 92%; Bovine: 92%;Trichoplax reptans: 91%; Florida lancelet: 90%; Starlet sea anemone: 85%; Blood fluke: 85%; Pea aphid: 85%; Yellowfever mosquito: 84%;Camponotus floridanus: 84%; Body louse: 84%; Savannah tsetse fly: 84%; Red flour beetle: 84%; Black-legged tick: 84%; Fruit fly: 84%; Southern house mosquito: 84%; Midge: 84%;Harpegnathos saltator: 81%; African malaria mosquito: 81%;.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- Description SFRS9 Polyclonal specifically detects SFRS9 in Human samples
- It is validated for Western Blot, Immunohistochemistry.
Compare Similar Items
Show Difference
Antigen: SFRS9
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Pre-mRNA-splicing factor SRp30C, serine/arginine-rich splicing factor 9, SFRS9, Splicing factor, arginine/serine-rich 9SR splicing factor 9, SRp30c
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 8683
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
Gene Accession No.: Q13242
Gene Symbols: SRSF9
Immunogen: Synthetic peptides corresponding to SFRS9(splicing factor, arginine/serine-rich 9) The peptide sequence was selected from the middle region of SFRS9. Peptide sequence VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence:Caenorhabditis briggsaeAF16: 100%;Caenorhabditis elegans: 100%; Western clawed frog: 100%; Xenopus: 100%; Rat: 100%; Mouse: 100%;Caenorhabditis vulgaris: 100%; Canine: 100%; Human: 100%; Zebrafish: 92%; Chicken: 92%; Sumatran orangutan: 92%; Green puffer: 92%; Pig: 92%; Eye worm: 92%; Atlantic salmon: 92%; Filarial nematode worm: 92%; Bovine: 92%;Trichoplax reptans: 91%; Florida lancelet: 90%; Starlet sea anemone: 85%; Blood fluke: 85%; Pea aphid: 85%; Yellowfever mosquito: 84%;Camponotus floridanus: 84%; Body louse: 84%; Savannah tsetse fly: 84%; Red flour beetle: 84%; Black-legged tick: 84%; Fruit fly: 84%; Southern house mosquito: 84%; Midge: 84%;Harpegnathos saltator: 81%; African malaria mosquito: 81%;.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: APOBEC2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2, ARCD1, ARP1, EC 3.5.4, EC 3.5.4.-, probable C->U-editing enzyme APOBEC-2
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 10930
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q9Y235
Gene Symbols: APOBEC2
Immunogen: Synthetic peptides corresponding to APOBEC2 (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2) The peptide sequence was selected from the N terminal of APOBEC2. Peptide sequence VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Rat: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: APOBEC2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2, ARCD1, ARP1, EC 3.5.4, EC 3.5.4.-, probable C->U-editing enzyme APOBEC-2
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 10930
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q9Y235
Gene Symbols: APOBEC2
Immunogen: Synthetic peptides corresponding to APOBEC2 (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2) The peptide sequence was selected from the N terminal of APOBEC2. Peptide sequence VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPAN
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
