Manufacturer: Novus Biologicals
Pack Size | SKU | Availability | Price |
---|---|---|---|
Each of 1 | NBP157465-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157465 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
SFRS9
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Pre-mRNA-splicing factor SRp30C, serine/arginine-rich splicing factor 9, SFRS9, Splicing factor, arginine/serine-rich 9SR splicing factor 9, SRp30c
Rabbit
Affinity purified
RUO
8683
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry
Q13242
SRSF9
Synthetic peptides corresponding to SFRS9(splicing factor, arginine/serine-rich 9) The peptide sequence was selected from the middle region of SFRS9. Peptide sequence VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER.
100 μL
Primary
Expected identity based on immunogen sequence:Caenorhabditis briggsaeAF16: 100%;Caenorhabditis elegans: 100%; Western clawed frog: 100%; Xenopus: 100%; Rat: 100%; Mouse: 100%;Caenorhabditis vulgaris: 100%; Canine: 100%; Human: 100%; Zebrafish: 92%; Chicken: 92%; Sumatran orangutan: 92%; Green puffer: 92%; Pig: 92%; Eye worm: 92%; Atlantic salmon: 92%; Filarial nematode worm: 92%; Bovine: 92%;Trichoplax reptans: 91%; Florida lancelet: 90%; Starlet sea anemone: 85%; Blood fluke: 85%; Pea aphid: 85%; Yellowfever mosquito: 84%;Camponotus floridanus: 84%; Body louse: 84%; Savannah tsetse fly: 84%; Red flour beetle: 84%; Black-legged tick: 84%; Fruit fly: 84%; Southern house mosquito: 84%; Midge: 84%;Harpegnathos saltator: 81%; African malaria mosquito: 81%;.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
IgG