Manufacturer: Novus Biologicals
Pack Size | SKU | Availability | Price |
---|---|---|---|
Each of 1 | NBP157907-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157907 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Alkaline Phosphatase/ALPP
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
Rabbit
59 kDa
100 μL
Embryonic Stem Cell Markers, Stem Cell Markers
250
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
1 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
P05187
ALPP
Synthetic peptides corresponding to ALPP(alkaline phosphatase, placental (Regan isozyme)) The peptide sequence was selected from the C terminal of ALPP (NP_001623). Peptide sequence TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA.
Protein A purified
RUO
Primary
Expected identity based on immunogen sequence: Human: 100%; Xenopus: 85%; Canine: 85%; Western clawed frog: 85%; Green puffer: 85%; Yellowfever mosquito: 84%; Shewanella baltica BA175: 84%; Shewanella baltica OS183: 84%; Shewanella baltica OS678: 84%; Shewanella benthica KT99: 84%; Pseudoalteromonas tunicata D2: 84%; Alteromonadales bacterium TW-7: 84%; Sea squirt: 78%; Chicken: 78%; Zebrafish: 78%; Mouse: 78%; Atlantic cod: 78%; Rat: 78%; Silk moth: 78%; Wild silk moth: 78%; Bovine: 78%; Florida lancelet: 78%; Savannah tsetse fly: 78%; Congregibacter litoralis KT71: 76%; Black-legged tick: 76%; Red flour beetle: 76%; Gamma proteobacterium HTCC2207: 76%; Fruit fly: 76%; Encephalitis mosquito: 75%;.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Purified