Manufacturer: Novus Biologicals
Pack Size | SKU | Availability | Price |
---|---|---|---|
Each of 1 | NBP157487-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157487 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
SNRP70
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP
Rabbit
51 kDa
100 μL
Primary
Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Western clawed frog: 100%; Bovine: 100%; Zebrafish: 100%; Xenopus: 100%; Canine: 100%; Rat: 100%; African malaria mosquito: 92%; Yellowfever mosquito: 92%; Mosquito: 92%;Harpegnathos saltator: 92%;Camponotus floridanus: 92%; Brown alga: 92%; Red flour beetle: 92%; Florida lancelet: 92%; Black-legged tick: 92%;Trichoplax reptans: 92%; Fruit fly: 92%;Caenorhabditis elegans: 85%;Caenorhabditis vulgaris: 85%; Eye worm: 85%; Body louse: 85%;Caenorhabditis briggsae: 85%; Filarial nematode worm: 85%; Planarian: 85%; Starlet sea anemone: 85%;Toxoplasma gondiiME49: 84%;Toxoplasma gondii: 84%; Blood fluke: 83%; Moss: 76%; Spikemoss: 76%;Volvox carteri f. nagariensis: 76%;Chlorella variabilis: 76%;Chlamydomonas smithii: 76%;.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
P08621
SNRNP70
Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70 (NP_003080). Peptide sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
RUO
6625
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.