Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157949-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157949 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Protein Disulfide Isomerase/P4HB
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Cellular thyroid hormone-binding protein, collagen prolyl 4-hydroxylase beta, DSI, ERBA2L, GIT, glutathione-insulin transhydrogenase, P4Hbeta, p55, PDIA1procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase-associated 1), PDIEC 5.3.4.1, PHDB, PO4DB, PO4HB, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide, PROHBprocollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase; thyroid hormone binding protein p55), Prolyl 4-hydroxylase subunit beta, prolyl 4-hydroxylase, beta polypeptide, protein disulfide isomerase family A, member 1, protein disulfide isomerase/oxidoreductase, protein disulfide isomerase-associated 1, protein disulfide-isomerase, protocollagen hydroxylase, thyroid hormone-binding protein p55
Rabbit
55 kDa
100 μL
Cellular Markers, ER Markers, Fibroblast Cell Markers, Hypoxia
5034
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P07237
P4HB
Synthetic peptides corresponding to Protein Disulfide Isomerase/P4HB (procollagen-proline, 2-oxoglutarate 4-dioxygenase, beta polypeptide) The peptide sequence was selected from the N terminal of Protein Disulfide Isomerase/P4HB. Peptide sequence TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
RUO
Primary
Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Canine: 85%; Xenopus: 78%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG