SFPQ Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157458-Each-of-1 | In Stock | ₹ 42,737.22 |
NBP157458 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
SFPQ
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 78%; Rat: 78%.
Target Species
Human, Mouse, Rat, Bovine, Canine
Form
Purified
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
P23246
Gene Symbols
SFPQ
Immunogen
Synthetic peptides corresponding to SFPQ (splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)) The peptide sequence was selected from the N terminal of SFPQ. Peptide sequence VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Research Discipline
DNA Repair, DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
6421
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- Description SFPQ Polyclonal specifically detects SFPQ in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SFPQ
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: 100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 78%; Rat: 78%.
Target Species: Human, Mouse, Rat, Bovine, Canine
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: P23246
Gene Symbols: SFPQ
Immunogen: Synthetic peptides corresponding to SFPQ (splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)) The peptide sequence was selected from the N terminal of SFPQ. Peptide sequence VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 6421
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: LARP6
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 93%; Equine: 93%; Pig: 93%; Canine: 92%; Mouse: 92%; Rat: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
Form: __
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9BRS8
Gene Symbols: LARP6
Immunogen: Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 55323
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: LARP6
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Form: __
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: Q9BRS8
Gene Symbols: LARP6
Immunogen: Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC.
Quantity: 20 μL
Research Discipline: __
Gene ID (Entrez): 55323
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Isotype: IgG
