CDKN3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP158079-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP158079 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
CDKN3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Bovine: 85%; Canine: 85%; Guinea pig: 85%; Mouse: 85%; Pig: 85%; Rat: 85%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q16667
Gene Symbols
CDKN3
Immunogen
Synthetic peptides corresponding to CDKN3(cyclin-dependent kinase inhibitor 3 (CDK2-associated dual specificity phosphatase)) The peptide sequence was selected from the C terminal of CDKN3. Peptide sequence CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
Gene ID (Entrez)
1033
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CDKN3 Polyclonal specifically detects CDKN3 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: CDKN3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Bovine: 85%; Canine: 85%; Guinea pig: 85%; Mouse: 85%; Pig: 85%; Rat: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q16667
Gene Symbols: CDKN3
Immunogen: Synthetic peptides corresponding to CDKN3(cyclin-dependent kinase inhibitor 3 (CDK2-associated dual specificity phosphatase)) The peptide sequence was selected from the C terminal of CDKN3. Peptide sequence CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
Gene ID (Entrez): 1033
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ERK4/MAPK4
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 2.7.11, EC 2.7.11.24, ERK3, Erk3-related, Erk4, ERK-4, Extracellular signal-regulated kinase 4, MAP kinase 4, MAP kinase isoform p63, MAPK 4, mitogen-activated protein kinase 4, p63MAPK, PRKM4p63-MAPK
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Rabbit: 92%; Zebrafish: 78%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P31152
Gene Symbols: MAPK4
Immunogen: Synthetic peptides corresponding to MAPK4(mitogen-activated protein kinase 4) The peptide sequence was selected from the middle region of MAPK4. Peptide sequence DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD.
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 5596
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: H2A
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: H2A histone family, member O, H2A.2, H2A/O, H2A/q, H2a-615, H2AFOHistone H2A/o, HIST2H2AAH2A, histone 2, H2aa, histone 2, H2aa3, histone cluster 2, H2aa3, histone H2A type 2-A, Histone H2A.2
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Bovine: 100%; Rat: 100%; Crab-eating macaque: 100%; western European house mouse: 100%; Long-tailed dwarf hamster: 100%; Gairdner's shrew-mouse: 100%; Human: 100%; Chicken: 85%;.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q7L7L0
Gene Symbols: HIST2H2AA3
Immunogen: Synthetic peptides corresponding to HIST2H2AA3(histone cluster 2, H2aa3) The peptide sequence was selected from the middle region of HIST2H2AA3. Peptide sequence PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 8337
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.