Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159114-Each-of-1 | In Stock | ₹ 43,387.50 |
NBP159114 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
RPSA
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 37LRPNEM/1CHD4, 67 kDa laminin receptor, 67kD, ribosomal protein SA, 67LR, Colon carcinoma laminin-binding protein, LAMBR37 kDa laminin receptor, laminin binding protein, Laminin receptor 1, laminin receptor 1 (67kD, ribosomal protein SA), Laminin-binding protein precursor p40, lamR, LAMR 1 LAMR140S ribosomal protein SA, LBP, LBP/p40, LRP, LRP/LR, Multidrug resistance-associated protein MGr1-Ag, p40, ribosomal protein SA
Rabbit
33 kDa
100 μL
Core ESC Like Genes, Cytoskeleton Markers, Extracellular Matrix, Neuroscience, Stem Cell Markers
3921
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
P08865
RPSA
Synthetic peptides corresponding to RPSA(ribosomal protein SA) The peptide sequence was selected from the middle region of RPSA (NP_002286). Peptide sequence TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY.
Affinity purified
RUO
Primary
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Sheep: 100%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
IgG