SLC6A15 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159653-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159653 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
SLC6A15
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3
Host Species
Rabbit
Molecular Weight of Antigen
82 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Rat 85%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q9H2J7
Gene Symbols
SLC6A15
Immunogen
Synthetic peptides corresponding to SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15) The peptide sequence was selected from the middle region of SLC6A15)(50ug). Peptide sequence YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
55117
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SLC6A15 Polyclonal specifically detects SLC6A15 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: SLC6A15
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3
Host Species: Rabbit
Molecular Weight of Antigen: 82 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Rat 85%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9H2J7
Gene Symbols: SLC6A15
Immunogen: Synthetic peptides corresponding to SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15) The peptide sequence was selected from the middle region of SLC6A15)(50ug). Peptide sequence YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 55117
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ATP6V0C
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ATP6CATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATP6LVPPC, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, ATPL, H(+)-transporting two-sector ATPase, 16 kDa subunit, vacuolar ATP synthase 16 kDa proteolipid subunit, vacuolar H+ ATPase proton channel subunit, Vacuolar proton pump 16 kDa proteolipid subunit, VATL, V-ATPase 16 kDa proteolipid subunit, Vma3, V-type proton ATPase 16 kDa proteolipid subunit
Host Species: Rabbit
Molecular Weight of Antigen: 16 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Sheep
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P27449
Gene Symbols: ATP6V0C
Immunogen: Synthetic peptide directed towards the middle region of human ATP6V0C (NP_001685). Peptide sequence VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 527
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: MCT1/SLC16A1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS with 0.02% Sodium Azide
Gene Alias: FLJ36745, HHF7, MCT, MCT 1, MCT1MGC44475, member 1, monocarboxylate transporter 1, Solute carrier family 16 member 1, solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Host Species: Rabbit
Molecular Weight of Antigen: 54 kDa
Quantity: 0.1 mg
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Concentration: 1.0 mg/mL
Dilution: Western Blot 2.5 μg/mL, Immunohistochemistry 1:200, Immunocytochemistry/Immunofluorescence 1:100 - 1:250, Immunohistochemistry-Paraffin 1:200, Knockdown Validated
Gene Accession No.: P53985
Gene Symbols: SLC16A1
Immunogen: A synthetic peptide made to an internal portion of the human Monocarboxylic acid transporter 1 protein (between residues 200-300) [UniProt P53985]
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6566
Reconstitution: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
