SLCO2B1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159811-Each-of-1 | In Stock | ₹ 42,908.34 |
NBP159811 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,908.34
GST (18%): ₹ 7,723.501
Total Price: ₹ 50,631.841
Antigen
SLCO2B1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
OATP2B1OATP-RP2, OATPBDKFZp686E0517, OATP-BKIAA0880, OATPRP2, Organic anion transporter B, Organic anion transporter polypeptide-related protein 2, SLC21A9solute carrier organic anion transporter family member 2B1, solute carrier family 21 (organic anion transporter), member 9, Solute carrier family 21 member 9, solute carrier organic anion transporter family, member 2B1
Host Species
Rabbit
Molecular Weight of Antigen
77 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Equine: 92%; Xenopus: 85%; Chicken: 85%; Zebrafish: 78%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.
O94956
Gene Symbols
SLCO2B1
Immunogen
Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
11309
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SLCO2B1 Polyclonal specifically detects SLCO2B1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLCO2B1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: OATP2B1OATP-RP2, OATPBDKFZp686E0517, OATP-BKIAA0880, OATPRP2, Organic anion transporter B, Organic anion transporter polypeptide-related protein 2, SLC21A9solute carrier organic anion transporter family member 2B1, solute carrier family 21 (organic anion transporter), member 9, Solute carrier family 21 member 9, solute carrier organic anion transporter family, member 2B1
Host Species: Rabbit
Molecular Weight of Antigen: 77 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Equine: 92%; Xenopus: 85%; Chicken: 85%; Zebrafish: 78%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.: O94956
Gene Symbols: SLCO2B1
Immunogen: Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 11309
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ORP8
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: MGC126578, MGC133203, MST120, MSTP120, ORP-8, ORP8KIAA1451, OSBP10DKFZp686A11164, OSBP-related protein 8, oxysterol binding protein-like 8, oxysterol-binding protein-related protein 8
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Rabbit: 100%; Equine: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 78%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Accession No.: Q68D75
Gene Symbols: OSBPL8
Immunogen: Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the N terminal of OSBPL8. Peptide sequence SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 114882
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ORP8
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: MGC126578, MGC133203, MST120, MSTP120, ORP-8, ORP8KIAA1451, OSBP10DKFZp686A11164, OSBP-related protein 8, oxysterol binding protein-like 8, oxysterol-binding protein-related protein 8
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry
Gene Accession No.: Q68D75
Gene Symbols: OSBPL8
Immunogen: Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the N terminal of OSBPL8. Peptide sequence SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS.
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 114882
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
